AibGenesis™ Mouse Anti-NEMP1 Antibody (MO-AB-16662R)


Cat: MO-AB-16662R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-16662R Monoclonal Cattle (Bos taurus), Zebrafish WB, ELISA MO16662R 100 µg
MOFY-1222-FY68 Polyclonal Zebrafish WB, IHC, ICC, IF, ELISA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Zebrafish
CloneMO16662R
SpecificityThis antibody binds to Cattle NEMP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against NEMP1. It can be used for NEMP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 194A; TMEM194A
UniProt IDA7MBC7
Protein RefseqThe length of the protein is 445 amino acids long.
The sequence is show below: MAGGMKVAVLPAVGAGPWSWGAGGCGAVRLLLVLFGCFVCGSAGIDLNVVTLRESEILFMNTSRQSCYKNVLIPKWHDIWTRIQIRVNSSKLVRVTQVENEDKLKELEQFSIWNFFSSFLKEKLNDTYINVGLYSTKTCLKVEILEEDTKYSVIVTRRFDPKLFLIFLLGLTLFFCGDLLSRSQIFYYSTGMSVGIVASLLIIIFIVSKFMPKKSPIYIILVGGWSFSLYLIQLVFKNLQEIWRCYWQYLLSYVL.
For Research Use Only | Not For Clinical Use.
Online Inquiry