Mouse Anti-NF1 Antibody (MO-AB-45773W)


Cat: MO-AB-45773W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-45773W Monoclonal Horse (Equus caballus), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), C. elegans (Caenorhabditis elegans), Rat (Rattus norvegicus), Pig (Sus scrofa), Rhesus (Macaca mulatta), Sheep (Ovis aries) WB, ELISA MO45773W 100 µg
CBMOAB-25601FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO25601FYA 100 µg
MO-AB-04675W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04675W 100 µg
MO-AB-07453W Monoclonal Cat (Felis catus) WB, ELISA MO07453W 100 µg
MO-AB-10695W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10695W 100 µg
MO-AB-32153W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32153W 100 µg
MO-AB-16678R Monoclonal Cattle (Bos taurus) WB, ELISA MO16678R 100 µg
MO-AB-27728R Monoclonal Pig (Sus scrofa) WB, ELISA MO27728R 100 µg
MO-AB-03116Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03116Y 100 µg
MO-AB-16316Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16316Y 100 µg
MO-DKB-00448W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), C. elegans (Caenorhabditis elegans), Rat (Rattus norvegicus) WB, IF, IP, KD 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), C. elegans (Caenorhabditis elegans), Rat (Rattus norvegicus), Pig (Sus scrofa), Rhesus (Macaca mulatta), Sheep (Ovis aries)
CloneMO45773W
SpecificityThis antibody binds to Horse NF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene product appears to function as a negative regulator of the ras signal transduction pathway. Mutations in this gene have been linked to neurofibromatosis type 1, juvenile myelomonocytic leukemia and Watson syndrome. The mRNA for this gene is subject to RNA editing (CGA>UGA->Arg1306Term) resulting in premature translation termination. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene.
Product OverviewMouse Anti-Horse NF1 Antibody is a mouse antibody against NF1. It can be used for NF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNeurofibromatosis type 1; NF1
UniProt IDQ8WMY8
Protein RefseqThe length of the protein is48 amino acids long.
The sequence is show below: VYCHSVELRNMFGETLHKAVQGCGAHPAIRMAPMPTSHYFVWQWASVA.
For Research Use Only | Not For Clinical Use.
Online Inquiry