AibGenesis™ Mouse Anti-ngfb Antibody (MO-AB-09520W)


Cat: MO-AB-09520W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09520W Monoclonal Cat (Felis catus), Dog (Canis lupus familiaris), Horse (Equus caballus) WB, ELISA MO09520W 100 µg
MO-AB-32167W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32167W 100 µg
MO-AB-45781W Monoclonal Horse (Equus caballus) WB, ELISA MO45781W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Dog (Canis lupus familiaris), Horse (Equus caballus)
CloneMO09520W
SpecificityThis antibody binds to Cat ngfb.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cat ngfb Antibody is a mouse antibody against ngfb. It can be used for ngfb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNerve Growth Factor beta subunit; ngfb
UniProt IDQ6ZY27
Protein RefseqThe length of the protein is 96 amino acids long.
The sequence is show below: RRARSTPAGAIAARVAGQTRNITVDPKLFKKRRLRSPRVLFSTHPPPVAADTQGLDLEAGGAASFNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVG.
For Research Use Only | Not For Clinical Use.
Online Inquiry