AibGenesis™ Mouse Anti-NGFRAP1 Antibody (MO-AB-04715W)


Cat: MO-AB-04715W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-04715W Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO04715W 100 µg
MO-AB-21565W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21565W 100 µg
MO-AB-60048W Monoclonal Marmoset WB, ELISA MO60048W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO04715W
SpecificityThis antibody binds to Rhesus NGFRAP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus NGFRAP1 Antibody is a mouse antibody against NGFRAP1. It can be used for NGFRAP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein BEX3 isoform b; NGFRAP1
UniProt IDH9ENA0
Protein RefseqThe length of the protein is 101 amino acids long.
The sequence is show below: MEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP.
For Research Use Only | Not For Clinical Use.
Online Inquiry