AibGenesis™ Mouse Anti-NHE-2 Antibody (MO-AB-27746R)


Cat: MO-AB-27746R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-27746R Monoclonal Pig (Sus scrofa), Horse (Equus caballus) WB, ELISA MO27746R 100 µg
MO-AB-45782W Monoclonal Horse (Equus caballus) WB, ELISA MO45782W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa), Horse (Equus caballus)
CloneMO27746R
SpecificityThis antibody binds to Pig NHE-2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against NHE-2. It can be used for NHE-2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNa+/H+ exchanger isoform 2, Fragment; NHE-2
UniProt IDQ9TTZ4
Protein RefseqThe length of the protein is 144 amino acids long.
The sequence is show below: VVGIGGVMIGIFLGFIAAFTTRFTHNVRVIEPLFVFLYSYLSYITAEMFHLSGIMAITACAMTMNKYVEENVSQKSYTTIKYFMKMLSSVSETLIFIFMGVSTVGKNHEWHWAFVCFTLAFCLIWRALGVFVLTQVINWFRTIP.
For Research Use Only | Not For Clinical Use.
Online Inquiry