Mouse Anti-Nile tilapia fech Antibody (MO-AB-33084H)


Cat: MO-AB-33084H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityNile tilapia (Oreochromis niloticus)
CloneMO33084C
SpecificityThis antibody binds to Nile tilapia fech.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is localized to the mitochondrion, where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Mutations in this gene are associated with erythropoietic protoporphyria. Two transcript variants encoding different isoforms have been found for this gene. A pseudogene of this gene is found on chromosome 3.
Product OverviewThis product is a mouse antibody against fech. It can be used for fech detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFerrochelatase; EC 4.99.1.1; LOC100692139
UniProt IDI3K4D5
Protein RefseqThe length of the protein is 403 amino acids long.
The sequence is show below: MMAALGSAGRLIQFARSSVSLSLRRRSTAAAAAFAQTPDTQENRKPKTGILMLNMGGPEKLEDVHDFLLRLFMDTDLMKLPVQNKLGPFIAKRRTPKIQEQYSKIGGGSPIKHWTSMQGEGMVKLLDEMSPETAPHKFYIGFRYVHPLTEEAIEEMEKDGVERAVAFTQYPQYSCSTTGSSLNAIYRYYSNRADRPKMRWSVIDRWPTHPLLVECFAEHIRNELLKFPEDKRDDVVILFSAHSLPMAVVNRGDPYPQEVGATVQRVMERLGHCNPYRLVWQSRVGPMPWLGPQTDEVIKGLCERGKKNLLLVPIAFTSDHIETLHELDIEYRQVLGEECGVENIRRAESLNGNPLFMKALADLVQSHLKSNEPCSRQLTLRCPLCTNPTCGEAKAFFANQKLS.
See other products for " FECH "
MO-AB-23206HMouse Anti-Mallard FECH Antibody (MO-AB-23206H)
CBMOAB-76310FYAMouse Anti-Zebrafish fech Antibody (CBMOAB-76310FYA)
MO-AB-30755WMouse Anti-Dog FECH Antibody (MO-AB-30755W)
MO-AB-22959WMouse Anti-Chimpanzee FECH Antibody (MO-AB-22959W)
MO-AB-08060YMouse Anti-Rabbit FECH Antibody (MO-AB-08060Y)
MO-AB-25808RMouse Anti-Pig FECH Antibody (MO-AB-25808R)
CBMOAB-42793FYAMouse Anti-Rhesus FECH Antibody (CBMOAB-42793FYA)
MO-AB-55379WMouse Anti-Marmoset FECH Antibody (MO-AB-55379W)
MO-AB-06472YMouse Anti-O. anatinus FECH Antibody (MO-AB-06472Y)
MO-AB-44724WMouse Anti-Horse FECH Antibody (MO-AB-44724W)
For Research Use Only | Not For Clinical Use.
Online Inquiry