Mouse Anti-Nile tilapia Sox17 Antibody (MO-AB-33830H)
Cat: MO-AB-33830H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Nile tilapia (Oreochromis niloticus) |
Clone | MO33830C |
Specificity | This antibody binds to Nile tilapia Sox17. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. |
Product Overview | This product is a mouse antibody against Sox17. It can be used for Sox17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | SRY-box containing transcription factor 17; Sox17 |
UniProt ID | Q197R3 |
Protein Refseq | The length of the protein is 75 amino acids long. The sequence is show below: VKRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKSLPITEKQPFVEEAERLRVQHMQDHPNYKYRPRRK. |
See other products for " SOX17 "
CBMOAB-58780FYA | Mouse Anti-Rhesus SOX17 Antibody (CBMOAB-58780FYA) |
MO-AB-29117H | Mouse Anti-Rat Sox17 Antibody (MO-AB-29117H) |
CBMOAB-06943FYB | Mouse Anti-Zebrafish sox17 Antibody (CBMOAB-06943FYB) |
MO-AB-04098Y | Mouse Anti-Chicken Sox17 Antibody (MO-AB-04098Y) |
MO-AB-01653R | Mouse Anti-Medaka sox17 Antibody (MO-AB-01653R) |
MO-AB-65124W | Mouse Anti-Marmoset SOX17 Antibody (MO-AB-65124W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry