Mouse Anti-Nile tilapia UBA2 Antibody (MO-AB-33962H)


Cat: MO-AB-33962H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityNile tilapia (Oreochromis niloticus)
CloneMO33962C
SpecificityThis antibody binds to Nile tilapia UBA2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPosttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 (MIM 613294) and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins.
Product OverviewThis product is a mouse antibody against UBA2. It can be used for UBA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMHC class IA antigen; UBA2
UniProt IDA0PAQ6
Protein RefseqThe length of the protein is 282 amino acids long.
The sequence is show below: KHSLKFFFCQTSGVQNIPEFVVVGLVDGVQKSYYDSNTGRPEPKTEWMKKLMKDDPQHLEWYTARSFHTQDLFKHYTENLRKRFNQTEGVHILQSMNGCEWDDETGQINAFNQYGYDGEDFLTFDPQRLTWIALKLQAVITKLRWDGEEDQLKCNKNFYIHECPEILKKYIQCGKNFSQTAVLPSVSLLQKSSSSPVSCHATGFYPDRGLMFWRIDGEELHEGLDPGEILPNNDGTFQLSVDLKLSSVTPEDWQRYDCVFQLSGGEDNIVTKLNKTLIRTNW.
See other products for " UBA2 "
MO-AB-06792WMouse Anti-Rhesus UBA2 Antibody (MO-AB-06792W)
CBMOAB-11420FYBMouse Anti-Zebrafish uba2 Antibody (CBMOAB-11420FYB)
MO-AB-22470RMouse Anti-Cattle UBA2 Antibody (MO-AB-22470R)
MO-AB-12716WMouse Anti-Chimpanzee UBA2 Antibody (MO-AB-12716W)
CBMOAB-04752CRMouse Anti-Yeast UBA2 Antibody (CBMOAB-04752CR)
CBMOAB-61641FYAMouse Anti-Rhesus UBA2 Antibody (CBMOAB-61641FYA)
MO-AB-67244WMouse Anti-Marmoset UBA2 Antibody (MO-AB-67244W)
CBMOAB-12585HCBMouse Anti-C. elegans UBA2 Antibody (CBMOAB-12585HCB)
CBMOAB-45427FYCMouse Anti-Arabidopsis UBA2 Antibody (CBMOAB-45427FYC)
CBMOAB-33779FYAMouse Anti-D. melanogaster Uba2 Antibody (CBMOAB-33779FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry