Mouse Anti-NIPAL4 Antibody (CBMOAB-52662FYA)


Cat: CBMOAB-52662FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52662FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Zebrafish (Danio rerio) WB, ELISA MO52662FYA 100 µg
CBMOAB-89030FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO89030FYA 100 µg
MO-AB-05631H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05631C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Zebrafish (Danio rerio)
CloneMO52662FYA
SpecificityThis antibody binds to Rhesus NIPAL4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus NIPAL4 Antibody is a mouse antibody against NIPAL4. It can be used for NIPAL4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNIPAL4
UniProt IDF7FAH5
Protein RefseqThe length of the protein is 361 amino acids long.
The sequence is show below: LSQLAGKYQAELCFYIGLGAFLSSFLIGSSVILKKKGLLRLVATGATRAVDGGFGYLKDTMWWAGFLTMAAGEVANFGAYAFAPATVVTPLGALSVLISAILSSYFLGESLNLLGKLGCVICVAGSTVMVIHAPEEEKVTTIMEMASKMKDTGFIVFAVLLLVSCLILIFVIAPRYGQRNILIYIIICSVIGAFSVAAVKGLGITIKNFFQGLPVVRHPLPYILSLILALSLSTQVNFLNRALDIFNTSLVFPIYYVFFTTVVVTSSIILFKEWYSMSAVDIAGTLSGFVTIILGVFMLHAFKDLDISCASLPHMHKNPPPSPAPEPTVIRLEDKNVLVDNIELASTSSPEEKPKVFIIHS.
For Research Use Only | Not For Clinical Use.
Online Inquiry