Mouse Anti-NIPSNAP2 Antibody (CBMOAB-60334FYC)


Cat: CBMOAB-60334FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60334FYC Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO60334FYC 100 µg
MO-AB-11035W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11035W 100 µg
MO-AB-16748R Monoclonal Cattle (Bos taurus) WB, ELISA MO16748R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO60334FYC
SpecificityThis antibody binds to Rhesus NIPSNAP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the NipSnap family of proteins that may be involved in vesicular transport. The encoded protein is localized to mitochondria and plays a role in oxidative phosphorylation. A pseudogene of this gene is located on the long arm of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus NIPSNAP2 Antibody is a mouse antibody against NIPSNAP2. It can be used for NIPSNAP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein NipSnap homolog 2 isoform 1; NIPSNAP2
UniProt IDI2CWV1
Protein RefseqThe length of the protein is 286 amino acids long.
The sequence is show below: MAARVLRARGAAWAGGLLRRAAPCSLLPRLRTWTSSSNRSREDSWLKSLFVRKVDPRKDAHSNLLAKKETSNLYKLQFHNVKPECLEAYNKICQEVLPKIHEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENKEFLEFRKARSDMLLSRKNQLLLEFSFWNEPVPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPLQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry