Mouse Anti-NKAIN1 Antibody (CBMOAB-52677FYA)


Cat: CBMOAB-52677FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52677FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO52677FYA 100 µg
CBMOAB-89352FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO89352FYA 100 µg
MO-AB-17795W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17795W 100 µg
MO-AB-27489H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27489C 100 µg
MO-AB-60090W Monoclonal Marmoset WB, ELISA MO60090W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO52677FYA
SpecificityThis antibody binds to Rhesus NKAIN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionNKAIN1 is a member of a family of mammalian proteins with similarity to Drosophila Nkain and interacts with the beta subunit of Na,K-ATPase (ATP1B1; MIM 182330) (Gorokhova et al., 2007 [PubMed 17606467]).
Product OverviewMouse Anti-Rhesus NKAIN1 Antibody is a mouse antibody against NKAIN1. It can be used for NKAIN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNKAIN1
UniProt IDF7GRX1
Protein RefseqThe length of the protein is 161 amino acids long.
The sequence is show below: MAVILGIFGTVQYRSRYLILYAAWLVLWVGWNAFIICFYLEVGQLSQDRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYVSKVFLEEEDSFDFIGGFDSYGYQAPQKTSHLQLQPLYT.
For Research Use Only | Not For Clinical Use.
Online Inquiry