AibGenesis™ Mouse Anti-NMS Antibody (CBMOAB-52782FYA)


Cat: CBMOAB-52782FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52782FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO52782FYA 100 µg
CBMOAB-89522FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO89522FYA 100 µg
MO-AB-16811R Monoclonal Cattle (Bos taurus) WB, ELISA MO16811R 100 µg
MO-AB-27517H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27517C 100 µg
MO-AB-27768R Monoclonal Pig (Sus scrofa) WB, ELISA MO27768R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO52782FYA
SpecificityThis antibody binds to Rhesus NMS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the neuromedin family of neuropeptides. The encoded preproprotein is proteolytically processed to generate a biologically active neuropeptide that plays a role in the regulation of circadian rhythm, anorexigenic action, antidiuretic action, cardiovascular function and stimulation of oxytocin and vasopressin release. (From NCBI)
Product OverviewMouse Anti-Rhesus NMS Antibody is a mouse antibody against NMS. It can be used for NMS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNMS
UniProt IDF7HEY2
Protein RefseqThe length of the protein is 153 amino acids long.
The sequence is show below: MKPLRPQFPLILIIYCFCMLQIPSSGFPQPLADPPDGLDIVQLEQLAYCLSQWASLSRQPKDNQDIYKRFLFHYSRTQEVTHPVKSEFPPVHPLMHLAAKLANRRMKRFLQRGSGTAAVDFTKKDHTATWGRPFFLFRPRNGRNTEDEAQIQW.
For Research Use Only | Not For Clinical Use.
Online Inquiry