Mouse Anti-Noc Antibody (CBMOAB-25772FYA)


Cat: CBMOAB-25772FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-25772FYA Monoclonal Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus) WB, ELISA MO25772FYA 100 µg
MO-AB-03170Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03170Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chicken (Gallus gallus)
CloneMO25772FYA
SpecificityThis antibody binds to fruit fly Noc.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Noc Antibody is a mouse antibody against Noc. It can be used for Noc detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNo ocelli, isoform B; noc
UniProt IDX2J9V3
Protein RefseqThe length of the protein is 537 amino acids long.
The sequence is show below: MVVLEGGGGVVTIGNNQYLQPDYLAPLPTTMDAKKSPLALLAQTCSQIGADSSAVKPLLAMDKNKTKPGACSSSSNSSSSSGSAEISAAKSPSGQAKSPKSSTPISSTATSASLSNTSTGEIKLAFKPYETNVLSHQNQNSFKSSSSLDAEPTRPSSKNSSSAQERVPSRSKSNATPTDGGKAEISAHDSSSSRKTVSPSGSSQRGASPIVRSGMEVLNNANGTAQHPKEMSSMAAAAAAAAAAYKAAGPYGLNPLSALCCPPGMEQHANPAFRPPFAGGFSHHHAAMLAVAANGGYPGGAPGGGPAGQPNPYISYQRIKTPAGGEAIVPVCKDPYCQGCPYSAHTQQMLMGAPCPAGCTQCEHQKYGLAMASAAGLPPAHPYSQAAAAAAANAAAARSAPYVCSWVVGDAYCGKRFQTSDELFSHLRTHTGNLSDPAAAAAALAQSQAQSLLGTLFPPSALRAGYPTPPLSPMSAAAAAARYHPYAKPPPGALAGGPSPFGAAGAFNPAAAAAAAALGPYYSPYAMYGQRMGAAHQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry