AibGenesis™ Mouse Anti-NOC3L Antibody (CBMOAB-52796FYA)


Cat: CBMOAB-52796FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52796FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO52796FYA 100 µg
CBMOAB-89556FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO89556FYA 100 µg
MO-AB-16827R Monoclonal Cattle (Bos taurus) WB, ELISA MO16827R 100 µg
MO-AB-18997W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18997W 100 µg
MO-AB-27781R Monoclonal Pig (Sus scrofa) WB, ELISA MO27781R 100 µg
MO-AB-43312W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43312W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO52796FYA
SpecificityThis antibody binds to Rhesus NOC3L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus NOC3L Antibody is a mouse antibody against NOC3L. It can be used for NOC3L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNOC3L
UniProt IDF7GTD9
Protein RefseqThe length of the protein is 798 amino acids long.
The sequence is show below: MKARRNKKQIPSFRKLIKTSKVKLENKLKNKQFKQQSTLKKYRKEQRKLRQAVKDAVSKKPIPLENPKEKRPGKRIEREEEEEEALPLDMMDEDDLQLMKDLGQRASFLTRDLSSSEPVHAKKRKHEHIIDKYEKIPRTLQTAPEKELIHLLPIKDKSGIIPQTREKPVTDSNKDEEDQEEERELEEEITEDPIQELTIEEHLIERKKKLQEKKMHIAALASAVLSDPESNIKKLKELRSMLMEQDPDVAVTVRKLVIVSLMELFKDITPSYKIRPLTEAEKSTKTRKETQKLREFEEGLVSQYKFYLENLEQMVKAYIALIMKVNSVQCSVLCSERQVLYTIFYQLLVLLLQFLXHNNIIVLIVPLMNDVSKSISEMCCEAVKKLFKQDKLGQASLGVIKVISGFVKGRNYEVRPEMLKTFLCLRIKEVEVKKDTEDINKPKKFMTFKEKRKSLSRMQRKWKKAEEKLERELREAEASESAEKKLKLHTETLNIVFVTYFRILKKAQRSPLLPAVLEGLAKFAHLINVEFFDDLLVVLHTLIESGDLSYQESLHCVQTAFHILSGQGDVLNIDPMKFYTHLYKTLFKLHAGATNEGVEIVLQCLDVMLTKRRKQVSQQRALAFIKRLCTLALHVLPNSSIGILATTRILMHTFPKTDLLLDSESQGSGVFLPELDEPEYCNAQNTALWELHALRRHYHPIVQRFAAHLIAGAPSEGSGALKPELSRRSAAELFEAYSMAEMTFNPPVESSNPKIKGKVLQGDSFLNEDLNQLIKRYSSEVATELPLDFTKYLKTSLH.
For Research Use Only | Not For Clinical Use.
Online Inquiry