AibGenesis™ Mouse Anti-NOV Antibody (MO-AB-16860R)
Cat: MO-AB-16860R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus), Chimpanzee (Pan troglodytes) |
| Clone | MO16860R |
| Specificity | This antibody binds to Cattle NOV. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. (From NCBI) |
| Product Overview | This product is a mouse antibody against NOV. It can be used for NOV detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Nephroblastoma overexpressed protein, Fragment; NOV |
| UniProt ID | O97574 |
| Protein Refseq | The length of the protein is 58 amino acids long. The sequence is show below: YRTEATLGVAVSDSSINCIEQTTEWSACSKSCGMGFSTRVTNRNPHCEMVKQTRLCMV. |
See other products for " NOV "
| CBMOAB-37462FYC | AibGenesis™ Mouse Anti-NOV Antibody (CBMOAB-37462FYC) |
| CBMOAB-52860FYA | AibGenesis™ Mouse Anti-NOV Antibody (CBMOAB-52860FYA) |
| MO-AB-03190Y | AibGenesis™ Mouse Anti-NOV Antibody (MO-AB-03190Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry