AibGenesis™ Mouse Anti-NOV Antibody (MO-AB-16860R)


Cat: MO-AB-16860R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-16860R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO16860R 100 µg
MO-AB-22353W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22353W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO16860R
SpecificityThis antibody binds to Cattle NOV.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. (From NCBI)
Product OverviewThis product is a mouse antibody against NOV. It can be used for NOV detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNephroblastoma overexpressed protein, Fragment; NOV
UniProt IDO97574
Protein RefseqThe length of the protein is 58 amino acids long.
The sequence is show below: YRTEATLGVAVSDSSINCIEQTTEWSACSKSCGMGFSTRVTNRNPHCEMVKQTRLCMV.
For Research Use Only | Not For Clinical Use.
Online Inquiry