AibGenesis™ Mouse Anti-NPDC1 Antibody (CBMOAB-52883FYA)


Cat: CBMOAB-52883FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52883FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO52883FYA 100 µg
MO-AB-14108W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14108W 100 µg
MO-AB-16873R Monoclonal Cattle (Bos taurus) WB, ELISA MO16873R 100 µg
MO-AB-60246W Monoclonal Marmoset WB, ELISA MO60246W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO52883FYA
SpecificityThis antibody binds to Rhesus NPDC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSuppresses oncogenic transformation in neural and non-neural cells and down-regulates neural cell proliferation. Might be involved in transcriptional regulation. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus NPDC1 Antibody is a mouse antibody against NPDC1. It can be used for NPDC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNeural proliferation differentiation and control protein 1; NPDC1
UniProt IDI0FFN4
Protein RefseqThe length of the protein is 325 amino acids long.
The sequence is show below: MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDAAACPGSLDCALKRRSRCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKARQRLPEPATLGFSARGQGLELGLPSTPGTPMPTPHTSLGSPVSSEPVHMSPLEPRGGHGDGLALVLILAFCVAGVAALSVASLCWCRLQREIRLTQKTDYTAAKSPGSPAAPRISPGDQRLAHSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPGSPPALP.
For Research Use Only | Not For Clinical Use.
Online Inquiry