Mouse Anti-NQO1 Antibody (CBMOAB-52938FYA)


Cat: CBMOAB-52938FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52938FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO52938FYA 100 µg
CBMOAB-89830FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO89830FYA 100 µg
MO-AB-05743H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05743C 100 µg
MO-AB-16904R Monoclonal Cattle (Bos taurus) WB, ELISA MO16904R 100 µg
MO-AB-18665W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18665W 100 µg
MO-AB-42168W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42168W 100 µg
MO-AB-60284W Monoclonal Marmoset WB, ELISA MO60284W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Zebrafish (Danio rerio)
CloneMO52938FYA
SpecificityThis antibody binds to Rhesus NQO1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. This FAD-binding protein forms homodimers and reduces quinones to hydroquinones. This protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product OverviewMouse Anti-Rhesus NQO1 Antibody is a mouse antibody against NQO1. It can be used for NQO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNQO1
UniProt IDF6RW20
Protein RefseqThe length of the protein is 240 amino acids long.
The sequence is show below: MVGKRALIVLAHSERTSFNYAMKEAAVAALKKKGWEVAESDLYAMNFNPIISRKDITGKLKDPANFQYAAESTLAYKEGRLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFVGEFAYTLAAMYDKGPFQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK.
For Research Use Only | Not For Clinical Use.
Online Inquiry