Mouse Anti-NRL Antibody (CBMOAB-53005FYA)


Cat: CBMOAB-53005FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53005FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO53005FYA 100 µg
CBMOAB-90019FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO90019FYA 100 µg
MO-AB-05777H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05777C 100 µg
MO-AB-27571H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27571C 100 µg
MO-AB-42175W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42175W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO53005FYA
SpecificityThis antibody binds to Rhesus NRL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a basic motif-leucine zipper transcription factor of the Maf subfamily. The encoded protein is conserved among vertebrates and is a critical intrinsic regulator of photoceptor development and function. Mutations in this gene have been associated with retinitis pigmentosa and retinal degenerative diseases. (From NCBI)
Product OverviewMouse Anti-Rhesus NRL Antibody is a mouse antibody against NRL. It can be used for NRL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNeural retina-specific leucine zipper protein; NRL
UniProt IDH9Z9D6
Protein RefseqThe length of the protein is 239 amino acids long.
The sequence is show below: MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGSGEALGLSPEDAMELLQGQGPVPVDGPHGYYPGSPEETGAQHIQLAQRFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGPGSGELSHLFL.
For Research Use Only | Not For Clinical Use.
Online Inquiry