AibGenesis™ Mouse Anti-nrsn1 Antibody (CBMOAB-90058FYA)


Cat: CBMOAB-90058FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-90058FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO90058FYA 100 µg
MO-AB-05781H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05781C 100 µg
MO-AB-16951R Monoclonal Cattle (Bos taurus) WB, ELISA MO16951R 100 µg
MO-AB-27575H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27575C 100 µg
MO-AB-60347W Monoclonal Marmoset WB, ELISA MO60347W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO90058FYA
SpecificityThis antibody binds to Zebrafish nrsn1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay play an important role in neural organelle transport, and in transduction of nerve signals or in nerve growth. May play a role in neurite extension. May play a role in memory consolidation. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish nrsn1 Antibody is a mouse antibody against nrsn1. It can be used for nrsn1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:73062; nrsn1; zgc:7306
UniProt IDQ6P976
Protein RefseqThe length of the protein is 198 amino acids long.
The sequence is show below: MTSCSEICGSDYAEQTHGAVSSGYQGYGVRSYLHQFYEECTASIWERDEDFQTQRSASRWSSVLWKVCLALGALILVAGLSVLLVGYATPPRLEAFGEDELLFVDGRAVRFNRALDACKLAGAVLFCVGGSGMAVGLLLAACSQNSSKEELRLQQRFKERLAEIQASVQPVTRAPTPGDAKVPVTLSKVQNVQPGAET.
For Research Use Only | Not For Clinical Use.
Online Inquiry