AibGenesis™ Mouse Anti-NT5M Antibody (CBMOAB-53072FYA)


Cat: CBMOAB-53072FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53072FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO53072FYA 100 µg
MO-AB-27586H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27586C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO53072FYA
SpecificityThis antibody binds to Rhesus NT5M.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17. (From NCBI)
Product OverviewMouse Anti-Rhesus NT5M Antibody is a mouse antibody against NT5M. It can be used for NT5M detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNT5M
UniProt IDF6WAN5
Protein RefseqThe length of the protein is 227 amino acids long.
The sequence is show below: MIQPGGWCARRLCSAAVPAGRRGAAGGQGLAGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSVSSWSSLSFHIQGSGSPTAGEGLNPLSLVDSTDVFICTSPIKMFKYCPYEKYAWVEKHFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGKRAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC.
For Research Use Only | Not For Clinical Use.
Online Inquiry