Mouse Anti-NUCKS1 Antibody (CBMOAB-53121FYA)


Cat: CBMOAB-53121FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53121FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO53121FYA 100 µg
MO-AB-05810H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05810C 100 µg
MO-AB-17016R Monoclonal Cattle (Bos taurus) WB, ELISA MO17016R 100 µg
MO-AB-24505W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24505W 100 µg
MO-AB-27598H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27598C 100 µg
MO-AB-60446W Monoclonal Marmoset WB, ELISA MO60446W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO53121FYA
SpecificityThis antibody binds to Rhesus NUCKS1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a nuclear protein that is highly conserved in vertebrates. The conserved regions of the protein contain several consensus phosphorylation sites for casein kinase II and cyclin-dependent kinases, two putative nuclear localization signals, and a basic DNA-binding domain. It is phosphorylated in vivo by Cdk1 during mitosis of the cell cycle. (From NCBI)
Product OverviewMouse Anti-Rhesus NUCKS1 Antibody is a mouse antibody against NUCKS1. It can be used for NUCKS1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNUCKS1
UniProt IDF7GMA8
Protein RefseqThe length of the protein is 204 amino acids long.
The sequence is show below: VSSFYRNRKVVDYSQFQESDDAEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED.
For Research Use Only | Not For Clinical Use.
Online Inquiry