AibGenesis™ Mouse Anti-NUDT14 Antibody (MO-AB-60457W)


Cat: MO-AB-60457W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-60457W Monoclonal Marmoset, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO60457W 100 µg
CBMOAB-53133FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO53133FYA 100 µg
CBMOAB-90276FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO90276FYA 100 µg
MO-AB-16697W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16697W 100 µg
MO-AB-17024R Monoclonal Cattle (Bos taurus) WB, ELISA MO17024R 100 µg
MO-AB-27602H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27602C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO60457W
SpecificityThis antibody binds to Marmoset NUDT14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. This enzyme contains a Nudix hydrolase domain and is a UDPG pyrophosphatase that hydrolyzes UDPG to produce glucose 1-phosphate and UMP. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Marmoset NUDT14 Antibody is a mouse antibody against NUDT14. It can be used for NUDT14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUridine diphosphate glucose pyrophosphatase; NUDT14
UniProt IDU3DU67
Protein RefseqThe length of the protein is 222 amino acids long.
The sequence is show below: MERIEGASVGRCAASPYLRPLTLHYRQNGTQKSWDFMKTHDSVTVLLFNSSRRSLVLVKQFRPAVYAGEVERHFPGSLAAVDQDGPQELQPALPGSVGVMVELCAGLVDQPGLSLEEVACKEAWEECGYSLAPSDLRRVATYWSGVGLTGSRQTMFYTEVTDAQRRGPGGGLAEEGELTEVVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLSQVAPNLDLQ.
See other products for " NUDT14 "
For Research Use Only | Not For Clinical Use.
Online Inquiry