AibGenesis™ Mouse Anti-nudt17 Antibody (CBMOAB-90282FYA)


Cat: CBMOAB-90282FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-90282FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus) WB, ELISA MO90282FYA 100 µg
MO-AB-17028R Monoclonal Cattle (Bos taurus) WB, ELISA MO17028R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus)
CloneMO90282FYA
SpecificityThis antibody binds to Zebrafish nudt17.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProbably mediates the hydrolysis of some nucleoside diphosphate derivatives. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish nudt17 Antibody is a mouse antibody against nudt17. It can be used for nudt17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNucleoside diphosphate-linked moiety X motif 17; Nudix motif 17; EC 3.6.1.-; nudt1
UniProt IDQ4V8V2
Protein RefseqThe length of the protein is 300 amino acids long.
The sequence is show below: MEKVRRILVHLSKENAAPQCARFLQSITGHFVGSAEDQATVSCSLENNRFILGDRLCDGGVPLKRASFCPIKYLSDSEAVSLPSETLSRGVDVGVAVLLQSANQKLLLTRRASSLRSFPNVWVPPGGHVELDEKLLDAGLRELLEETGLNLSPDEICSRLLGLWESVYPPMLTIGLPKRHHIVTYILLKSSQTHLQIQASLRPDPAEVSACVWVDADLVKAVVSAVDGEKECVQIPADLPESIGVTKVSPDGEMSESSLPVSVLCNRAPDYGEDIERVSTGTKFALELWLKTLEHHADMG.
For Research Use Only | Not For Clinical Use.
Online Inquiry