Mouse Anti-numb Antibody (MO-AB-05824H)


Cat: MO-AB-05824H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-05824H Monoclonal Frog (Xenopus laevis), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Rhesus (Macaca mulatta) WB, ELISA MO05824C 100 µg
CBMOAB-26026FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO26026FYA 100 µg
CBMOAB-53162FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO53162FYA 100 µg
MO-AB-17040R Monoclonal Cattle (Bos taurus) WB, ELISA MO17040R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Rhesus (Macaca mulatta)
CloneMO05824C
SpecificityThis antibody binds to Frog numb.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against numb. It can be used for numb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNumb-like protein; numb
UniProt IDC6KH72
Protein RefseqThe length of the protein is 210 amino acids long.
The sequence is show below: MNKLRQSFRRKKDIYVPEASRPHQWQTDEESVRTGKCSFQVKYLGHVEVEESRGMHICEEAVKRLKSERKYFKGFFAKSGKKAIKAVLWVSADGLRVVDEKTKDLLVDQTIEKVTFCAPDRNFDRAFSYICRDGTTRRWICHCFMTVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTCTRKATFNASRTTFTREGSFRV.
For Research Use Only | Not For Clinical Use.
Online Inquiry