Mouse Anti-Nup37 Antibody (CBMOAB-26073FYA)


Cat: CBMOAB-26073FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-26073FYA Monoclonal Fruit fly (Drosophila melanogaster), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO26073FYA 100 µg
CBMOAB-53198FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO53198FYA 100 µg
CBMOAB-90355FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO90355FYA 100 µg
MO-AB-05832H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05832C 100 µg
MO-AB-19377W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19377W 100 µg
MO-AB-60504W Monoclonal Marmoset WB, ELISA MO60504W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO26073FYA
SpecificityThis antibody binds to fruit fly Nup37.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionNuclear pore complexes (NPCs) are used for transporting macromolecules between the cytoplasm and the nucleus. NPCs consist of multiple copies of 30 distinct proteins (nucleoporins), which assemble into biochemically-separable subcomplexes. The protein encoded by this gene is part of a subcomplex (Nup107-160) that is required for proper NPC function as well as for normal kinetochore-microtubule interaction and mitosis.
Product OverviewMouse Anti-D. melanogaster Nup37 Antibody is a mouse antibody against Nup37. It can be used for Nup37 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG11875; SD22926p; Nup37
UniProt IDQ9VBU8
Protein RefseqThe length of the protein is 320 amino acids long.
The sequence is show below: MRSVIEPDHSIQLNEAIYCYDICTNDFAYNLIAVAFRKHLSLLLVGLPEESGEFGYTRLQDMDLGEKEQRSVSALAFSPDTSLNCTPNNVTLCAANGSQLKLYRTDLGQFTSLQVLRGHGDYVNDVSWVCDGELLASVSDDFTCRFWTTTGGGENVITFGLSSAGMSVKSHPEDPNKVLVAEKKGIIHLYNVTLKQTVISVESPKFPLMSADWAHSNRLFITSLAGGDVVTWDLNRPYVPADVKQVHEDCGRVVRFAPGSSEMVIAMVIGLTLKVFAAKSTVPLLEASLKSYGGMAWHQRLPYISAVSDRKLLFWKVQMK.
For Research Use Only | Not For Clinical Use.
Online Inquiry