Mouse Anti-Nup58 Antibody (CBMOAB-26079FYA)


Cat: CBMOAB-26079FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-26079FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO26079FYA 100 µg
CBMOAB-37734FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO37734FC 100 µg
MO-AB-05838H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05838C 100 µg
MO-AB-17051R Monoclonal Cattle (Bos taurus) WB, ELISA MO17051R 100 µg
MO-AB-24922W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24922W 100 µg
MO-AB-60509W Monoclonal Marmoset WB, ELISA MO60509W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO26079FYA
SpecificityThis antibody binds to fruit fly Nup58.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the nucleoporin family that shares 87% sequence identity with rat nucleoporin p58. The protein is localized to the nuclear rim and is a component of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product OverviewMouse Anti-D. melanogaster Nup58 Antibody is a mouse antibody against Nup58. It can be used for Nup58 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProbable nucleoporin Nup58; Nup58
UniProt IDQ9VDV3
Protein RefseqThe length of the protein is 546 amino acids long.
The sequence is show below: MFTPTTNNAIGGATAATGAFAFGARPATTTAPPPSFGAATSTPTFGAAPATTSLFAAPAATPAFGAPAATPAFGAPASTPGFGATSTAAPAFGTAAATPAFGIPAATSAFGAPAATPAFGAAAATPAFGAPAATPAFGAPAATSAFGAPAATTAFGAPASTQASAFGAPAPAVGTVAPTFSFATPATSAPTTAPPAFGFGTTATTAAAAMPASLSSGIGSFSFPKPQATTAASLNFNTTTTTATAQPFNTGLKLGTTNATTTLGGGGIFSKPAGQAAAPAASTFVGLGGIDVTATQPKLGDNKQDGIKIKETQVPDEIIKTVDGLKAYIKQQKTISSDIGRTSTSKFTNVSHEITNLKWALQNMATLVEGSNQQIRLMRQETVKAIQSLEMAQRTQDTPAGLQFENNAPFQYFQCLVAKYEQDLIAFRQQIALTERHMHAISNPQSISPDDLKRGFRQLNESFISLAGRLHEVHQRVEEHKEHYLNLRRYRLRDTTNVFERIDNPPLPTVEPQRISSGPTPFSNISALMNKSYAAAASSASNATGN.
For Research Use Only | Not For Clinical Use.
Online Inquiry