AibGenesis™ Mouse Anti-O. mykiss CN147 Antibody (MO-AB-10959Y)


Cat: MO-AB-10959Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityO. mykiss (Oncorhynchus mykiss)
CloneMO10959Y
SpecificityThis antibody binds to O. mykiss CN147.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against CN147. It can be used for CN147 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesC14orf147 homolog; Oncorhynchus mykiss genomic scaffold, scaffold_268; CN147
UniProt IDC1BHM8
Protein RefseqThe length of the protein is 68 amino acids long. The sequence is show below: MAFEDVWKKISWLYYQYILVTALYMLEPWERAIFNSILISVAGMAVYTGYVFMPQHIMAILQYFEMVQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry