Mouse Anti-O. mykiss pgm Antibody (MO-AB-12765Y)
Cat: MO-AB-12765Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | O. mykiss (Oncorhynchus mykiss) |
Clone | MO12765Y |
Specificity | This antibody binds to O. mykiss pgm. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Phosphoglycerate mutase (PGM) is any enzyme that catalyzes step 8 of glycolysis. They catalyze the internal transfer of the phosphate group from C-3 to C-2, resulting in the conversion of 3-phosphoglycerate (3PG) to 2-phosphoglycerate (2PG) via a 2, 3-diphosphoglycerate intermediate. |
Product Overview | This product is a mouse antibody against pgm. It can be used for pgm detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Phosphoglucomutase; pgm |
UniProt ID | A0A060PFX0 |
Protein Refseq | The length of the protein is 80 amino acids long. The sequence is show below: SVSKNQGLRIVFSDGSRIIFRLSGTGSAGATVRLYIDSYEKDPAKIYGDAQVMLKPLVEIALKISGLHEKTGRTGPTVIT. |
See other products for " PGM "
MOFAB-238W | Arabidopsis PGM Antibody (MOFAB-238W) |
MO-AB-32188H | Mouse Anti-Soybean PGM Antibody (MO-AB-32188H) |
CBMOAB-38692FYC | Mouse Anti-Arabidopsis PGM Antibody (CBMOAB-38692FYC) |
CBMOAB-2015YC | Mouse Anti-E. coli pgm Antibody (CBMOAB-2015YC) |
CBMOAB-27543FYA | Mouse Anti-D. melanogaster Pgm Antibody (CBMOAB-27543FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry