Mouse Anti-O. mykiss pgm Antibody (MO-AB-12765Y)


Cat: MO-AB-12765Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityO. mykiss (Oncorhynchus mykiss)
CloneMO12765Y
SpecificityThis antibody binds to O. mykiss pgm.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPhosphoglycerate mutase (PGM) is any enzyme that catalyzes step 8 of glycolysis. They catalyze the internal transfer of the phosphate group from C-3 to C-2, resulting in the conversion of 3-phosphoglycerate (3PG) to 2-phosphoglycerate (2PG) via a 2, 3-diphosphoglycerate intermediate.
Product OverviewThis product is a mouse antibody against pgm. It can be used for pgm detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesPhosphoglucomutase; pgm
UniProt IDA0A060PFX0
Protein RefseqThe length of the protein is 80 amino acids long. The sequence is show below: SVSKNQGLRIVFSDGSRIIFRLSGTGSAGATVRLYIDSYEKDPAKIYGDAQVMLKPLVEIALKISGLHEKTGRTGPTVIT.
For Research Use Only | Not For Clinical Use.
Online Inquiry