Mouse Anti-O. mykiss RAF1 Antibody (MO-AB-12941Y)
Cat: MO-AB-12941Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | O. mykiss (Oncorhynchus mykiss) |
Clone | MO12941Y |
Specificity | This antibody binds to O. mykiss RAF1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene is the cellular homolog of viral raf gene (v-raf). The encoded protein is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. Once activated, the cellular RAF1 protein can phosphorylate to activate the dual specificity protein kinases MEK1 and MEK2, which in turn phosphorylate to activate the serine / threonine specific protein kinases, ERK1 and ERK2. Activated ERKs are pleiotropic effectors of cell physiology and play an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. Mutations in this gene are associated with Noonan syndrome 5 and LEOPARD syndrome 2. |
Product Overview | This product is a mouse antibody against RAF1. It can be used for RAF1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Serine/threonine protein kinase RAF1; RAF1 |
UniProt ID | Q6L767 |
Protein Refseq | The length of the protein is 51 amino acids long. The sequence is show below: LEFPQILSSIELLQHSLPKINRSASEPSLHRASHTEDINVFTSTYSRLPVF. |
See other products for " RAF1 "
MO-AB-28736R | Mouse Anti-Pig RAF1 Antibody (MO-AB-28736R) |
CBMOAB-03277CR | Mouse Anti-Yeast RAF1 Antibody (CBMOAB-03277CR) |
MO-AB-09637Y | Mouse Anti-Rabbit RAF1 Antibody (MO-AB-09637Y) |
MO-AB-06879H | Mouse Anti-Frog raf1 Antibody (MO-AB-06879H) |
CBMOAB-89015FYB | Mouse Anti-Rice RAF1 Antibody (CBMOAB-89015FYB) |
CBMOAB-55984FYA | Mouse Anti-Rhesus RAF1 Antibody (CBMOAB-55984FYA) |
MO-AB-62889W | Mouse Anti-Marmoset RAF1 Antibody (MO-AB-62889W) |
CBMOAB-39769FYC | Mouse Anti-Arabidopsis RAF1 Antibody (CBMOAB-39769FYC) |
MO-AB-16114W | Mouse Anti-Chimpanzee RAF1 Antibody (MO-AB-16114W) |
MO-AB-19004R | Mouse Anti-Cattle RAF1 Antibody (MO-AB-19004R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry