AibGenesis™ Mouse Anti-Oaf Antibody (CBMOAB-26139FYA)


Cat: CBMOAB-26139FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-26139FYA Monoclonal Fruit fly (Drosophila melanogaster), Chimpanzee (Pan troglodytes) WB, ELISA MO26139FYA 100 µg
MO-AB-22730W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22730W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chimpanzee (Pan troglodytes)
CloneMO26139FYA
SpecificityThis antibody binds to fruit fly Oaf.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Oaf Antibody is a mouse antibody against Oaf. It can be used for Oaf detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOut at first protein; [Cleaved into: Out at first short protein]; oaf
UniProt IDQ9NLA6
Protein RefseqThe length of the protein is 487 amino acids long.
The sequence is show below: MILKEEHPHQSIETAANAARQAQVRWRMAHLKALSRTRTPAHGNCCGRVVSKNHFFKHSRAFLWFLLCNLVMNADAFAHSQLLINVQNQGGEVIQESITSNIGEDLITLEFQKTDGTLITQVIDFRNEVQILKALVLGEEERGQSQYQVMCFATKFNKGDFISSAAMAKLRQKNPHTIRTPEEDKGRETFTMSSWVQLNRSLPITRHLQGLCAEAMDATYVRDVDLKAWAELPGSSISSLEAATEKFPDTLSTRCNEVSSLWAPCLCNLETCIGWYPCGLKYCKGKGVAGADSSGAQQQAQPTNYRCGIKTCRKCTQFTYYVRQKQQCLWDEXRRGELQLMQMRCARRRNGSEFGDDASATCPGGETRAATTTATITGGGAGGSGKDTTAATTTTTNKLRQLLLLVQQQMPFALWSFPVHHISQSHHQSQSQHKPSRQQKQHQHHSQVAPTSHHQSSSSTPPTPSTSSSPPSSSSSSSSSAMAAIVA.
For Research Use Only | Not For Clinical Use.
Online Inquiry