Mouse Anti-OAZ2 Antibody (CBMOAB-53275FYA)
Cat: CBMOAB-53275FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-53275FYA | Monoclonal | Rhesus (Macaca mulatta), Frog (Xenopus laevis), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO53275FYA | 100 µg | ||
| CBMOAB-90435FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO90435FYA | 100 µg | ||
| MO-AB-05861H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05861C | 100 µg | ||
| MO-AB-27634H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27634C | 100 µg | ||
| MO-AB-27896R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO27896R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Frog (Xenopus laevis), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO53275FYA |
| Specificity | This antibody binds to Rhesus OAZ2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Nucleus; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamines. Expression of antizymes requires +1 ribosomal frameshifting, which is enhanced by high levels of polyamines. Antizymes in turn bind to and inhibit ornithine decarboxylase (ODC), the key enzyme in polyamine biosynthesis; thus, completing the auto-regulatory circuit. This gene encodes antizyme 2, the second member of the antizyme family. Like antizyme 1, antizyme 2 has broad tissue distribution, inhibits ODC activity and polyamine uptake, and stimulates ODC degradation in vivo; however, it fails to promote ODC degradation in vitro. Antizyme 2 is expressed at lower levels than antizyme 1, but is evolutionary more conserved, suggesting it likely has an important biological role. Studies also show different subcellular localization of antizymes 1 and 2, indicating specific function for each antizyme in discrete compartments of the cell. Alternatively spliced transcript variants have been found for this gene. |
| Product Overview | Mouse Anti-Rhesus OAZ2 Antibody is a mouse antibody against OAZ2. It can be used for OAZ2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | OAZ2 |
| UniProt ID | F7D3N1 |
| Protein Refseq | The length of the protein is 188 amino acids long. The sequence is show below: ILSVSYSSILPLSNCPQLQCCRHIVPGPLWCDAPHPLSKIPGGRGGGRDPSLSALIYKDEKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFLGFEIVRPGHPCVPSRPDVMFMVYPLDQNLSDED. |
For Research Use Only | Not For Clinical Use.
Online Inquiry