Mouse Anti-OAZ2 Antibody (CBMOAB-53275FYA)


Cat: CBMOAB-53275FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53275FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO53275FYA 100 µg
CBMOAB-90435FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO90435FYA 100 µg
MO-AB-05861H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05861C 100 µg
MO-AB-27634H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27634C 100 µg
MO-AB-27896R Monoclonal Pig (Sus scrofa) WB, ELISA MO27896R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO53275FYA
SpecificityThis antibody binds to Rhesus OAZ2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamines. Expression of antizymes requires +1 ribosomal frameshifting, which is enhanced by high levels of polyamines. Antizymes in turn bind to and inhibit ornithine decarboxylase (ODC), the key enzyme in polyamine biosynthesis; thus, completing the auto-regulatory circuit. This gene encodes antizyme 2, the second member of the antizyme family. Like antizyme 1, antizyme 2 has broad tissue distribution, inhibits ODC activity and polyamine uptake, and stimulates ODC degradation in vivo; however, it fails to promote ODC degradation in vitro. Antizyme 2 is expressed at lower levels than antizyme 1, but is evolutionary more conserved, suggesting it likely has an important biological role. Studies also show different subcellular localization of antizymes 1 and 2, indicating specific function for each antizyme in discrete compartments of the cell. Alternatively spliced transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus OAZ2 Antibody is a mouse antibody against OAZ2. It can be used for OAZ2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOAZ2
UniProt IDF7D3N1
Protein RefseqThe length of the protein is 188 amino acids long.
The sequence is show below: ILSVSYSSILPLSNCPQLQCCRHIVPGPLWCDAPHPLSKIPGGRGGGRDPSLSALIYKDEKLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFLGFEIVRPGHPCVPSRPDVMFMVYPLDQNLSDED.
For Research Use Only | Not For Clinical Use.
Online Inquiry