Mouse Anti-OOEP Antibody (CBMOAB-53387FYA)


Cat: CBMOAB-53387FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53387FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO53387FYA 100 µg
MO-AB-04902W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04902W 100 µg
MO-AB-07840W Monoclonal Cat (Felis catus) WB, ELISA MO07840W 100 µg
MO-AB-16463Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16463Y 100 µg
MO-AB-17161R Monoclonal Cattle (Bos taurus) WB, ELISA MO17161R 100 µg
MO-AB-27928R Monoclonal Pig (Sus scrofa) WB, ELISA MO27928R 100 µg
MO-AB-32263W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32263W 100 µg
MO-AB-60604W Monoclonal Marmoset WB, ELISA MO60604W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO53387FYA
SpecificityThis antibody binds to Rhesus OOEP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus OOEP Antibody is a mouse antibody against OOEP. It can be used for OOEP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOOEP
UniProt IDF6X4G2
Protein RefseqThe length of the protein is 135 amino acids long.
The sequence is show below: AGAAESQRGKQTPADSLEQLRMLPLPPPQIRIRPWWFPVQELGDPLVFYLEAWLADELFGPDRAMIPEMEWTSQALMTVDIVDSGNLVEITVFGRPSVQNRVKSMLLCLASFHREHRARAEKMKHLEKNLKAHAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry