Mouse Anti-OPN3 Antibody (CBMOAB-53394FYA)


Cat: CBMOAB-53394FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53394FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Medaka (Oryzias latipes), Zebrafish (Danio rerio) WB, ELISA MO53394FYA 100 µg
CBMOAB-90638FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO90638FYA 100 µg
MO-AB-01138R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01138R 100 µg
MO-AB-26763W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26763W 100 µg
MO-AB-60623W Monoclonal Marmoset WB, ELISA MO60623W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Medaka (Oryzias latipes), Zebrafish (Danio rerio)
CloneMO53394FYA
SpecificityThis antibody binds to Rhesus OPN3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus OPN3 Antibody is a mouse antibody against OPN3. It can be used for OPN3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOPN3
UniProt IDF6VQK6
Protein RefseqThe length of the protein is 402 amino acids long.
The sequence is show below: MYSGNRSGGQGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL.
For Research Use Only | Not For Clinical Use.
Online Inquiry