AibGenesis™ Mouse Anti-OR10Z1 Antibody (CBMOAB-53424FYA)


Cat: CBMOAB-53424FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53424FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO53424FYA 100 µg
Inquiry
MO-AB-00928L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00928L 100 µg
Inquiry
MO-AB-09026W Monoclonal Cat (Felis catus) WB, ELISA MO09026W 100 µg
Inquiry
MO-AB-09084Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09084Y 100 µg
Inquiry
MO-AB-16470Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16470Y 100 µg
Inquiry
MO-AB-17190R Monoclonal Cattle (Bos taurus) WB, ELISA MO17190R 100 µg
Inquiry
MO-AB-18185W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18185W 100 µg
Inquiry
MO-AB-27942R Monoclonal Pig (Sus scrofa) WB, ELISA MO27942R 100 µg
Inquiry
MO-AB-35223W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35223W 100 µg
Inquiry
MO-AB-45858W Monoclonal Horse (Equus caballus) WB, ELISA MO45858W 100 µg
Inquiry
MO-AB-60636W Monoclonal Marmoset WB, ELISA MO60636W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO53424FYA
SpecificityThis antibody binds to Rhesus OR10Z1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR10Z1 Antibody is a mouse antibody against OR10Z1. It can be used for OR10Z1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR10Z1
UniProt IDF6YKV7
Protein RefseqThe length of the protein is 313 amino acids long.
The sequence is show below: MGQTNVTSWRDFVFLGFSGSGELQHLLFALFLSLYLVTLTSNVFIIIAIGLDSHLHTPMYLFLVFLSFSETCYTLGIIPRMLFGLAMGDQAISYVGCAAQMFFSASWACTNCFLLAAMGFDRYVAICAPLHYASRMNPNLCAQLVVTSFLIGYLFGLGMTLVIFHLSFCSSHEIQHFFCDTPPVLSLACGDTGLSELGILILSLLVLLVSFFFITISYAYILAAILKIPSAEGQKKAFSICASHLTVVIIHYGCASFMYLRPKASYSLERDQLIAMTYTVVTPLLNPIVYSLRNRAVQTALRNAFRGRLLGKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry