AibGenesis™ Mouse Anti-OR11G2 Antibody (CBMOAB-53425FYA)


Cat: CBMOAB-53425FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53425FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Gorilla, Marmoset, Rabbit (Oryctolagus cuniculus) WB, ELISA MO53425FYA 100 µg
MO-AB-09086Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09086Y 100 µg
MO-AB-09471W Monoclonal Cat (Felis catus) WB, ELISA MO09471W 100 µg
MO-AB-38644W Monoclonal Gorilla WB, ELISA MO38644W 100 µg
MO-AB-60637W Monoclonal Marmoset WB, ELISA MO60637W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Gorilla, Marmoset, Rabbit (Oryctolagus cuniculus)
CloneMO53425FYA
SpecificityThis antibody binds to Rhesus OR11G2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR11G2 Antibody is a mouse antibody against OR11G2. It can be used for OR11G2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR11G2
UniProt IDF7GIG2
Protein RefseqThe length of the protein is 284 amino acids long.
The sequence is show below: QILLFVLFTVVYFLTLMGNGSIICAVHWDQRLHIPMYILLANFSFLEIWYVTSTVPNMLANFLSDTKVISFSGCFLQFYLFFSLGSTECFFLAVMAFDRYLAICRPLHYPTIMTRRLCTNLVINCWVLGFIWFLIPIVIISQMSFCGPRIIDHFLCDPAPLLTLTCKKDPVIELIFSALCPLPVFVLFLFIMGSYALVLRAVLTVPSAAGRRKAFSTCGSHLTVVSMFYGSVIVMYGSPPSKNEAGKQKIVTLFYSVVTPLVNPVIYSLRNKDMKKSLKKLWGT.
For Research Use Only | Not For Clinical Use.
Online Inquiry