Mouse Anti-OR2A12 Antibody (MO-AB-08537W)


Cat: MO-AB-08537W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08537W Monoclonal Cat (Felis catus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo) WB, ELISA MO08537W 100 µg
MO-AB-16827W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16827W 100 µg
MO-AB-32482W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32482W 100 µg
MO-AB-35244W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35244W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo)
CloneMO08537W
SpecificityThis antibody binds to Cat OR2A12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Cat OR2A12 Antibody is a mouse antibody against OR2A12. It can be used for OR2A12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR2A12
UniProt IDM3WY27
Protein RefseqThe length of the protein is 310 amino acids long.
The sequence is show below: MGSNQTWITEVILLGFQVDPKLELFLFGFFLLFYSLTLMGNGMVLGLICWDSTLHTPMYFFLSNLAIVDMSYASSIVPKMLANLTMQKKTISFAPCLLQTFLYLALAVTECTSLVVMSYDRYVAICHPLHYAVIMSWRVCTILAATCWIFSFLLALVHITLILRLPFCGPQTIDHFFCQIMSVFRLACADTTLNQTVLFVGSVFVLVGPLCLVLVSYTCILFAILRIQSSESQRKAFSTCSSHLCVVGLFFGSAIVMYMAPKSRHSQEQRKILSLFYSLFNPMLNPLIYSLRNAEVKGALRRFQRKKTSV.
For Research Use Only | Not For Clinical Use.
Online Inquiry