AibGenesis™ Mouse Anti-OR2Y1 Antibody (CBMOAB-53471FYA)


Cat: CBMOAB-53471FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53471FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Guinea pig (Cavia porcellus) WB, ELISA MO53471FYA 100 µg
MO-AB-17237R Monoclonal Cattle (Bos taurus) WB, ELISA MO17237R 100 µg
MO-AB-18333W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18333W 100 µg
MO-AB-42221W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42221W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Guinea pig (Cavia porcellus)
CloneMO53471FYA
SpecificityThis antibody binds to Rhesus OR2Y1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR2Y1 Antibody is a mouse antibody against OR2Y1. It can be used for OR2Y1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR2Y1
UniProt IDF7E5E3
Protein RefseqThe length of the protein is 311 amino acids long.
The sequence is show below: MGSFNTSFEDAFILVGFSDWPQLEPILFIFILIFYSLTLFGNTIIIALSWLDLRLHTPMYFFLSHLSLLDLCFTTSTVPQLLINLCGVDRTITRGGCVAQLFIYLALGSTECVLLVVMAFDRYAAVFRPLHYMAIMHPRLCQTLAVASWGAGFVNSLIQTGLAMAMPLCGHQLNHFFCEMPVFLKLACADTEGTEAKMFVARVIIVVVPVALILGSYVHIARAVLRVKSMAGRRKAFGTCGCHLLVVFLFYGSAIYTYLQSIHNYSESEGKFVALFYTIITPILNPLIYTLRNKDVKGALWKVLWRGRDSG.
For Research Use Only | Not For Clinical Use.
Online Inquiry