AibGenesis™ Mouse Anti-OR4K17 Antibody (CBMOAB-53487FYA)


Cat: CBMOAB-53487FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53487FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus) WB, ELISA MO53487FYA 100 µg
MO-AB-09130Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09130Y 100 µg
MO-AB-12754W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12754W 100 µg
MO-AB-27957R Monoclonal Pig (Sus scrofa) WB, ELISA MO27957R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus)
CloneMO53487FYA
SpecificityThis antibody binds to Rhesus OR4K17.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR4K17 Antibody is a mouse antibody against OR4K17. It can be used for OR4K17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR4K17
UniProt IDF7GPD6
Protein RefseqThe length of the protein is 343 amino acids long.
The sequence is show below: MALYFSIILHGMSDIFFLSTGYVRASCMMESMELLNQSQVSEFILLGLTSSQDIEFLLFALFSVIYVVTVLGNLLIIVTVFNTPNLNTPMYFLLGNLSFVDMTLASFATPKMILNLLKKQKIISFAGCFTQIFLLHLLGGVEMVLLVSMAFDRYVAICKPLHYMTIMNKKVCVLLVVTSWLLGLLHSGLQIPFAVNLPFCGPNVVDSIFCDLPLVTKLACIDTYLVQIVIVANSGIISLSCFIILLISYSLILITIKNHSPTGQSKALSTLTAHITVVILFFGPCIFIYIWPFSNHSVDKFLAVFYTIITPILNPIIYTLRNKEMKISMKKLWRAFVNSREDT.
For Research Use Only | Not For Clinical Use.
Online Inquiry