AibGenesis™ Mouse Anti-OR4X1 Antibody (MO-AB-08124W)


Cat: MO-AB-08124W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08124W Monoclonal Cat (Felis catus), Cattle (Bos taurus), Rabbit (Oryctolagus cuniculus) WB, ELISA MO08124W 100 µg
MO-AB-09139Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09139Y 100 µg
MO-AB-17262R Monoclonal Cattle (Bos taurus) WB, ELISA MO17262R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Cattle (Bos taurus), Rabbit (Oryctolagus cuniculus)
CloneMO08124W
SpecificityThis antibody binds to Cat OR4X1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. This olfactory receptor gene is a segregating pseudogene, where some individuals have an allele that encodes a functional olfactory receptor, while other individuals have an allele encoding a protein that is predicted to be non-functional. (From NCBI)
Product OverviewMouse Anti-Cat OR4X1 Antibody is a mouse antibody against OR4X1. It can be used for OR4X1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; LOC101086844
UniProt IDM3WUH8
Protein RefseqThe length of the protein is 305 amino acids long.
The sequence is show below: MATTNNVTELILLGFSPNRDVQKTISVMFLLMYTAIVLGNGLIVVTIMGSKGLTSPMYFFLGYLSFVEICYCSVTAPKLILDSFIERKIISLKGCITQIFFLHFFGGTEIFLLTVMAYDRYVAICKPLHYTVIMNRRACGLLVGAAWGGGLLHSVGQTFLISQLPFCGPKVLDHYFCDVHPVLKLACSDTFLTGVLIIANGGSISVISFTVLLASYVVILHALSTQTSEGRRKALSTCASHVAVVGLFFIPCSFVYMRPCVTLPADKIVAVFYTVVTPLLNPIIYSFRNAEVKNAMRRLIGRKVI.
For Research Use Only | Not For Clinical Use.
Online Inquiry