AibGenesis™ Mouse Anti-OR51B5 Antibody (MO-AB-07462W)


Cat: MO-AB-07462W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07462W Monoclonal Cat (Felis catus), Ferret (Mustela Putorius Furo), Gorilla, Marmoset WB, ELISA MO07462W 100 µg
MO-AB-35282W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35282W 100 µg
MO-AB-38667W Monoclonal Gorilla WB, ELISA MO38667W 100 µg
MO-AB-60675W Monoclonal Marmoset WB, ELISA MO60675W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Ferret (Mustela Putorius Furo), Gorilla, Marmoset
CloneMO07462W
SpecificityThis antibody binds to Cat OR51B5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Cat OR51B5 Antibody is a mouse antibody against OR51B5. It can be used for OR51B5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR51B5
UniProt IDM3WFB7
Protein RefseqThe length of the protein is 312 amino acids long.
The sequence is show below: ERPNGNSSSFLLTGFPGLEAAHHWISTPFFFIYISVLLGNSTLLLLIKEDPNLHEPMYYFLAMLAATDLGLTLTTMPTVLRVLWLGHREIGKVACFSQAYFIHSLAFVESGVLLAMAYDRFIAIRNPLRYTSILTYTQVLKIGLGVLLRGFVSVIPPIVPLYFFPYCHSHVLSHAFCLHQDVIKLACADTTFNRLYPVVLVVFIFVLDSLIILISYVLILKSVLRIASKEERAKAFNTCVSHICCVLVFYVTVIGLSLIHRFGKQVPHIVHLTMSYVYFLFPPLMNPMIYSVKTKQIRSGFLHLFTNHHSPS.
For Research Use Only | Not For Clinical Use.
Online Inquiry