AibGenesis™ Mouse Anti-OR5D14 Antibody (CBMOAB-53525FYA)


Cat: CBMOAB-53525FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53525FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset WB, ELISA MO53525FYA 100 µg
MO-AB-20598W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20598W 100 µg
MO-AB-32550W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32550W 100 µg
MO-AB-60712W Monoclonal Marmoset WB, ELISA MO60712W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset
CloneMO53525FYA
SpecificityThis antibody binds to Rhesus OR5D14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR5D14 Antibody is a mouse antibody against OR5D14. It can be used for OR5D14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR5D14
UniProt IDF7G7F4
Protein RefseqThe length of the protein is 314 amino acids long.
The sequence is show below: LMMVLRNLSMETTFALLGFTDYPKLQIPLFLVFLLIYVITVVGNLGMIVIIKINPKLHTPMYFFLSHLSFVDFCYSSIVTPKLLETLVMADKSIFFFNCMMQYFLSCTAVVTESFLLAVMAYDRFVAICNPLLYTVAMSQRLCALLVAGSYLWGMFGPLVLLCYALRLNFSGPNVINHFFCEYTALIAVSSSDILIPHLLLFGFATFNEVCTLLIILASYVFIFVTVLKIHYASGRHKAFSTCASHLTAITIFHGTILSLYCVPNSKNSQQTVKVASVFYTVVNPMLNPLIYSLRNKDVKDAFWKLIHTQVPFH.
For Research Use Only | Not For Clinical Use.
Online Inquiry