AibGenesis™ Mouse Anti-OR5P3 Antibody (CBMOAB-53538FYA)


Cat: CBMOAB-53538FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53538FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Gorilla, Rabbit (Oryctolagus cuniculus) WB, ELISA MO53538FYA 100 µg
MO-AB-08314W Monoclonal Cat (Felis catus) WB, ELISA MO08314W 100 µg
MO-AB-09194Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09194Y 100 µg
MO-AB-18456W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18456W 100 µg
MO-AB-38678W Monoclonal Gorilla WB, ELISA MO38678W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Chimpanzee (Pan troglodytes), Gorilla, Rabbit (Oryctolagus cuniculus)
CloneMO53538FYA
SpecificityThis antibody binds to Rhesus OR5P3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR5P3 Antibody is a mouse antibody against OR5P3. It can be used for OR5P3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR5P3
UniProt IDF7GV23
Protein RefseqThe length of the protein is 312 amino acids long.
The sequence is show below: MGIRNHTTVTEFIILGLTEDPTLRDIFFVIFLGIYIVTLIGNIGIITLIRSCSQLHTPMYLFLSHLAFVDIGLSTVVTPIMLMGFLRHGVALPDTSCEAQLYSVVMFGTSECFLLATMAYDRYVAICSPLVYSTYLSPRVCILLVVACYLGGCVNASTFTSCLLNLSFCGPNHIDHFFCDFSPLLKLSCSDISIPEMIPSISSGSIIVVTVFVIAISYIYILITILKMRSNEGRHKAFSTCTSHLTAVTLYYGTITFIYVMPKSSYSTSQNTLISLSYTVVIPITNPFIYSLRNRDVKEALRKAAVRTNWET.
For Research Use Only | Not For Clinical Use.
Online Inquiry