AibGenesis™ Mouse Anti-OR8A1 Antibody (CBMOAB-53561FYA)


Cat: CBMOAB-53561FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53561FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo) WB, ELISA MO53561FYA 100 µg
MO-AB-17649W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17649W 100 µg
MO-AB-32575W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32575W 100 µg
MO-AB-35335W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35335W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo)
CloneMO53561FYA
SpecificityThis antibody binds to Rhesus OR8A1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR8A1 Antibody is a mouse antibody against OR8A1. It can be used for OR8A1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR8A1
UniProt IDF6THP1
Protein RefseqThe length of the protein is 326 amino acids long.
The sequence is show below: IGFLSPMHPCRPPAQRRMAAGNHSIVTEFILRGLTKRADLQLPLFLLFLGIYLVTMVGNLGMITLIRLNSQLHTPMYYFLSNLSLVDLCYSSVITPKMLVNFVSEKNIISYAGCMSQLYFFLVFVIAECYMLTVMAYDRYVAICHPLLYNIIMSHHTCSLLVAVVYAMGLIGSTIETGLMLKLPYCEPLISHYFCDILPLMKLSCSSTYDVEMAVFFLAGFNIIVTSLTVLVSYTFILSSILGISTTEGRSKAFSTCSSHLAAVGMFYGSTAFMYLKPSTISSLAQENVASVFYTTVIPMLNPLIYSLRNKEVKAAVQKTLRSKLF.
For Research Use Only | Not For Clinical Use.
Online Inquiry