Mouse Anti-OR8D1 Antibody (CBMOAB-53565FYA)


Cat: CBMOAB-53565FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53565FYA Monoclonal Rhesus (Macaca mulatta), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Pig (Sus scrofa) WB, ELISA MO53565FYA 100 µg
MO-AB-27982R Monoclonal Pig (Sus scrofa) WB, ELISA MO27982R 100 µg
MO-AB-32577W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32577W 100 µg
MO-AB-35338W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35338W 100 µg
MO-AB-45931W Monoclonal Horse (Equus caballus) WB, ELISA MO45931W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Pig (Sus scrofa)
CloneMO53565FYA
SpecificityThis antibody binds to Rhesus OR8D1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. (From NCBI)
Product OverviewMouse Anti-Rhesus OR8D1 Antibody is a mouse antibody against OR8D1. It can be used for OR8D1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR8D1
UniProt IDF7CIS2
Protein RefseqThe length of the protein is 307 amino acids long.
The sequence is show below: MTVENYSTATQFVLAGLTQQAEIQLPLFLLFLGIYLVTVVGNLGMVLLIAVSPLLHTPMYYLLSSLSFVDFCYSSVITPKMLVNFLGKNTILYSECMVQLFFFVVFVVAEGYLLTAMAYDRYVAICSPLLYNVIMSSWVCSPLVLAAFFLGFLSALAHTSAMMKLSFCKSHIINHYFCDVLPLLNLSCSNTYLNELLLFIIAGFKTLVPTLAVAISYAFIFYSILHIRSSEGRSKAFGTCSSHLMAVGIFFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKALRKVLVGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry