AibGenesis™ Mouse Anti-Orf13 Antibody (MO-AB-30154H)


Cat: MO-AB-30154H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-30154H Monoclonal Shrimp white spot syndrome virus, Rice WB, ELISA MO30154C 100 µg
MO-MMB-0529 Polyclonal Rice ELISA, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityShrimp white spot syndrome virus, Rice
CloneMO30154C
SpecificityThis antibody binds to Shrimp white spot syndrome virus Orf13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against Orf13. It can be used for Orf13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesORF13; WSSV520
UniProt IDQ91LM4
Protein RefseqThe length of the protein is 138 amino acids long.
The sequence is show below: MERRVGGFFLPFFGFWLVFLAPPSGVFGPPFPFPFPKAFLNAPPTPGIDPSAEAIVPASAVPARRDAKRGALIIITAITMTIIVIKSKPKSIFFPPPKDATNGEAILAILLLLLLLLLSPSMVVAHNNSVYYNIKRNI.
For Research Use Only | Not For Clinical Use.
Online Inquiry