Mouse Anti-ORMDL2 Antibody (CBMOAB-53595FYA)


Cat: CBMOAB-53595FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53595FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO53595FYA 100 µg
CBMOAB-90970FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO90970FYA 100 µg
MO-AB-17351R Monoclonal Cattle (Bos taurus) WB, ELISA MO17351R 100 µg
MO-AB-21189W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21189W 100 µg
MO-AB-27676H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27676C 100 µg
MO-AB-37903W Monoclonal Goat (Capra hircus) WB, ELISA MO37903W 100 µg
MO-AB-60752W Monoclonal Marmoset WB, ELISA MO60752W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO53595FYA
SpecificityThis antibody binds to Rhesus ORMDL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ORMDL2 Antibody is a mouse antibody against ORMDL2. It can be used for ORMDL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesORMDL2
UniProt IDF7GZ72
Protein RefseqThe length of the protein is 153 amino acids long.
The sequence is show below: MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHVVLLSIPFFSIPVVWTLTNVIHNLAMYVFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPITTHLKAFEDIKYDAAHFLINTASLLSVLLPKLPQFHGVRVFGINKY.
For Research Use Only | Not For Clinical Use.
Online Inquiry