AibGenesis™ Mouse Anti-ostn Antibody (CBMOAB-91037FYA)


Cat: CBMOAB-91037FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-91037FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO91037FYA 100 µg
MO-AB-03290Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03290Y 100 µg
MO-AB-17388R Monoclonal Cattle (Bos taurus) WB, ELISA MO17388R 100 µg
MO-AB-27685H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27685C 100 µg
MO-AB-28066R Monoclonal Pig (Sus scrofa) WB, ELISA MO28066R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO91037FYA
SpecificityThis antibody binds to Zebrafish ostn.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ostn Antibody is a mouse antibody against ostn. It can be used for ostn detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesostn; Osteocrin
UniProt IDE7F404
Protein RefseqThe length of the protein is 134 amino acids long.
The sequence is show below: MLGCGCVLLSCLLTLTLFHCSAESLHIPQGRPEYVESSVVEGRSVQRGQMEQKTSGALSAKLLLHDQLVRLENDVIETKRKRSFPGSNTPLDRLSISTMDPKSNKQRKAVELPRRRVSVPIDRIGVGRLPSSRG.
For Research Use Only | Not For Clinical Use.
Online Inquiry