AibGenesis™ Mouse Anti-oxld1 Antibody (CBMOAB-91144FYA)


Cat: CBMOAB-91144FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-91144FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO91144FYA 100 µg
MO-AB-17407R Monoclonal Cattle (Bos taurus) WB, ELISA MO17407R 100 µg
MO-AB-19984W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19984W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO91144FYA
SpecificityThis antibody binds to Zebrafish oxld1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish oxld1 Antibody is a mouse antibody against oxld1. It can be used for oxld1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesoxld1; Oxidoreductase Like Domain Containing 1
UniProt IDE7FGN4
Protein RefseqThe length of the protein is 131 amino acids long.
The sequence is show below: MNSLNAGSCLQRLCIFSMSLFRNKPPPSQITCVHHTACEQQCSSPDSSSSVSSVKKPLIPSSETGDEGPPSAPTHCCMSGCHNCVWIEYAEKLLKYYSDGGERALEAIEKNVLDDNLKAYLKMEIKLLKKT.
For Research Use Only | Not For Clinical Use.
Online Inquiry