AibGenesis™ Mouse Anti-oxnad1 Antibody (CBMOAB-91148FYA)


Cat: CBMOAB-91148FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-91148FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO91148FYA 100 µg
MO-AB-11277W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11277W 100 µg
MO-AB-17408R Monoclonal Cattle (Bos taurus) WB, ELISA MO17408R 100 µg
MO-AB-60826W Monoclonal Marmoset WB, ELISA MO60826W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO91148FYA
SpecificityThis antibody binds to Zebrafish oxnad1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish oxnad1 Antibody is a mouse antibody against oxnad1. It can be used for oxnad1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOxidoreductase NAD-binding domain-containing protein 1; oxnad1; XP_005170097.
UniProt IDI3ISI1
Protein RefseqThe length of the protein is 306 amino acids long.
The sequence is show below: MSAPCFVRTVARGFSGGSGLFRPAVLCSDKVTVTRKMTSRRRTDHLERTASVHRQMELFSARVCDIISESDTVKRLRLEVAHPDFSFRAGQWVDFFIPGVDTVGGFSICSSPGLLKREGVIELAVKYARHPPAHWIHTECSVDSQVAVRVGGNFYFDPQPSNPVVDLLLVAGGVGINPLYSILLHAADLHRHTHSHRYTPGHTHLCYSAKNTTELLFKDTIIDICHERPDKFSCHFHVTQQSSDIEPQLQPYTIRGRISAEELQRYVDPERTLCYLCGPPPMIEKVSSDLQSTGLPEDRILFEKWW.
For Research Use Only | Not For Clinical Use.
Online Inquiry