Mouse Anti-P2RX1 Antibody (MO-AB-09271Y)
Cat: MO-AB-09271Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-09271Y | Monoclonal | Rabbit (Oryctolagus cuniculus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO09271Y | 100 µg | ||
CBMOAB-91166FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO91166FYA | 100 µg | ||
MO-AB-04947W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO04947W | 100 µg | ||
MO-AB-08040W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08040W | 100 µg | ||
MO-AB-13426W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13426W | 100 µg | ||
MO-AB-35363W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35363W | 100 µg | ||
MO-AB-60842W | Monoclonal | Marmoset | WB, ELISA | MO60842W | 100 µg | ||
MO-AB-17421R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO17421R | 100 µg | ||
MO-AB-01254R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01254R | 100 µg | ||
MO-AB-28079R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28079R | 100 µg | ||
MO-AB-23566H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23566C | 100 µg | ||
MO-AB-01035L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01035L | 100 µg | ||
MO-AB-17007Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17007Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rabbit (Oryctolagus cuniculus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO09271Y |
Specificity | This antibody binds to Rabbit P2RX1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Plasma membrane |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene belongs to the P2X family of G-protein-coupled receptors. These proteins can form homo-and heterotimers and function as ATP-gated ion channels and mediate rapid and selective permeability to cations. This protein is primarily localized to smooth muscle where binds ATP and mediates synaptic transmission between neurons and from neurons to smooth muscle and may being responsible for sympathetic vasoconstriction in small arteries, arterioles and vas deferens. Mouse studies suggest that this receptor is essential for normal male reproductive function. This protein may also be involved in promoting apoptosis. P2RX1 (Purinergic Receptor P2X 1) is a protein coding gene. Diseases associated with P2RX1 include Bleeding Disorder, Platelet-Type, 8 and Neurogenic Bladder. Among its related pathways are Platelet homeostasis and Response to elevated platelet cytosolic Ca2+. Gene Ontology (GO) annotations related to this gene include ion channel activity and calcium channel activity. An important paralog of this gene is P2RX4.Ligand-gated ion channel with relatively high calcium permeability. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Seems to be linked to apoptosis, by increasing the intracellular concentration of calcium in the presence of ATP, leading to programmed cell death. (From uniprot, under CC BY 4.0) |
Product Overview | This product is a mouse antibody against P2RX1. It can be used for P2RX1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | P2X purinoceptor; P2RX1 |
UniProt ID | G1U3D6 |
Protein Refseq | The length of the protein is 399 amino acids long. The sequence is show below: MARRLQDELAAFFFEYDTPRMVLVRNKKVGVVFRLIQLLVLAYVVGWVFVYEKGYQTSSGLISSVSVKLKGLAVTQLGDVGAQVWDVADYVFPAQGDSSFVVMTNFIVTLRQTQRHCAEHPEGGTCRDDSGCTPGKAERKAQGIRSGKCVAFNDSVRTCEIFGWCPVEVDDHVPSPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNASYMRTCLYHKTAHPLCPVFQLGYVVQESGQNFSSLAEKGGAVGITIDWNCDLDWHVRHCKPIYAFHGLYAEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVNGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGAGERDPAATSSTLVLQENMKTS. |
See other products for " P2rx1 "
MO-AB-42270W | Mouse Anti-P2rx1 Antibody (MO-AB-42270W) |
MO-AB-45957W | Mouse Anti-P2RX1 Antibody (MO-AB-45957W) |
CBMOAB-53696FYA | Mouse Anti-P2RX1 Antibody (CBMOAB-53696FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry